PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00044776-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family Nin-like
Protein Properties Length: 533aa    MW: 60415.6 Da    PI: 7.4463
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00044776-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK832.8e-26382431352
            RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ++i l+dl+kyF+ pi++A+++L+v+lT+LKr+CR++GI+RWPhRkiksl
  PSME_00044776-RA 382 ANIALKDLAKYFDVPITEASRSLKVGLTALKRKCREFGIPRWPHRKIKSL 431
                       79**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.872366451IPR003035RWP-RK domain
PfamPF020426.3E-22383431IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MAGDDVASLN AFPSHPLIYF SVWWTKCYHH QPHHFLHFMA MESYSASESS PSHLHLCALA  60
VFQNLLNEEL IKSVHLYQLQ DGTISAIQRE FMFFPSSYKQ IGLENIPPVH VCGKENLQEF  120
MANLQEGEER GLWICILHYN CNLRPINFTI PNILNLARNP ALKTIPELAI DLDRVARFKQ  180
ALDSSHPQKY LGEKMLNCEL TGMQSTFLGI EGFWPAIPGL TTVQDCIDDA LNRPSNVIEI  240
PLSIDQIDNS YGIKNICNED NPNPNPGQPI TPYLEGCSSC NPKEVGSITG NNSRCLEKDN  300
HTADQKSSLS IVDMAVIQSI DHSHVPQNLR NDASEDPSML CSKKTNQELP SGAGVKGQKR  360
RASSEEKDEN RQIHRAPTQR VANIALKDLA KYFDVPITEA SRSLKVGLTA LKRKCREFGI  420
PRWPHRKIKS LDSLIHDLQE EAKRQEREDK AAAMAAMKRT RILETERQKI EKKPGIDIQK  480
DTKRFRQDIF KRRHKARALK KKHEFSNSNS EDGDQSEEVP SVSTILSLMN HDR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ0788044e-99FJ078804.2 Pinus taeda isolate 7711 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788054e-99FJ078805.2 Pinus taeda isolate 7721 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788064e-99FJ078806.2 Pinus taeda isolate 7709 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788074e-99FJ078807.2 Pinus taeda isolate 7710 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788084e-99FJ078808.2 Pinus taeda isolate 7718 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788094e-99FJ078809.2 Pinus taeda isolate 7719 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788104e-99FJ078810.2 Pinus taeda isolate 7713 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788114e-99FJ078811.2 Pinus taeda isolate 7716 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788124e-99FJ078812.2 Pinus taeda isolate 7714 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788134e-99FJ078813.2 Pinus taeda isolate 7717 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788144e-99FJ078814.2 Pinus taeda isolate 7715 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788154e-99FJ078815.2 Pinus taeda isolate 7722 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788164e-99FJ078816.2 Pinus taeda isolate 7723 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788184e-99FJ078818.2 Pinus taeda isolate 7724 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788194e-99FJ078819.2 Pinus taeda isolate 7707 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788204e-99FJ078820.2 Pinus taeda isolate 7720 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788214e-99FJ078821.2 Pinus taeda isolate 7712 anonymous locus 0_6885_01 genomic sequence.
GenBankJQ2613634e-99JQ261363.1 Pinus radiata isolate 7725 hypothetical protein (0_6885_01) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGGLYMA01G36360.14e-55(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.11e-37RWP-RK domain-containing protein